TPT1 monoclonal antibody (M06), clone 2A3
  • TPT1 monoclonal antibody (M06), clone 2A3

TPT1 monoclonal antibody (M06), clone 2A3

Ref: AB-H00007178-M06
TPT1 monoclonal antibody (M06), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPT1.
Información adicional
Size 100 ug
Gene Name TPT1
Gene Alias FLJ27337|HRF|TCTP|p02
Gene Description tumor protein, translationally-controlled 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7178
Clone Number 2A3
Iso type IgG2b Kappa

Enviar uma mensagem


TPT1 monoclonal antibody (M06), clone 2A3

TPT1 monoclonal antibody (M06), clone 2A3