TPT1 polyclonal antibody (A01)
  • TPT1 polyclonal antibody (A01)

TPT1 polyclonal antibody (A01)

Ref: AB-H00007178-A01
TPT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TPT1.
Información adicional
Size 50 uL
Gene Name TPT1
Gene Alias FLJ27337|HRF|TCTP|p02
Gene Description tumor protein, translationally-controlled 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7178

Enviar uma mensagem


TPT1 polyclonal antibody (A01)

TPT1 polyclonal antibody (A01)