TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007177-D01P
TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPSAB1 protein.
Información adicional
Size 100 ug
Gene Name TPSAB1
Gene Alias MCP7|TPS1|TPS2|TPSB1
Gene Description tryptase alpha/beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPSAB1 (NP_003285.2, 1 a.a. ~ 275 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7177

Enviar uma mensagem


TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)

TPSAB1 purified MaxPab rabbit polyclonal antibody (D01P)