TPR monoclonal antibody (M05), clone 1F8
  • TPR monoclonal antibody (M05), clone 1F8

TPR monoclonal antibody (M05), clone 1F8

Ref: AB-H00007175-M05
TPR monoclonal antibody (M05), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPR.
Información adicional
Size 100 ug
Gene Name TPR
Gene Alias -
Gene Description translocated promoter region (to activated MET oncogene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPR (NP_003283, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7175
Clone Number 1F8
Iso type IgG1 Kappa

Enviar uma mensagem


TPR monoclonal antibody (M05), clone 1F8

TPR monoclonal antibody (M05), clone 1F8