TPD52 polyclonal antibody (A01)
  • TPD52 polyclonal antibody (A01)

TPD52 polyclonal antibody (A01)

Ref: AB-H00007163-A01
TPD52 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TPD52.
Información adicional
Size 50 uL
Gene Name TPD52
Gene Alias D52|N8L|PC-1|PrLZ|hD52
Gene Description tumor protein D52
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7163

Enviar uma mensagem


TPD52 polyclonal antibody (A01)

TPD52 polyclonal antibody (A01)