TPBG purified MaxPab mouse polyclonal antibody (B01P)
  • TPBG purified MaxPab mouse polyclonal antibody (B01P)

TPBG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007162-B01P
TPBG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPBG protein.
Información adicional
Size 50 ug
Gene Name TPBG
Gene Alias 5T4|5T4-AG|M6P1
Gene Description trophoblast glycoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILNHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPBG (NP_006661.1, 1 a.a. ~ 420 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7162

Enviar uma mensagem


TPBG purified MaxPab mouse polyclonal antibody (B01P)

TPBG purified MaxPab mouse polyclonal antibody (B01P)