TPBG polyclonal antibody (A01)
  • TPBG polyclonal antibody (A01)

TPBG polyclonal antibody (A01)

Ref: AB-H00007162-A01
TPBG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TPBG.
Información adicional
Size 50 uL
Gene Name TPBG
Gene Alias 5T4|5T4-AG|M6P1
Gene Description trophoblast glycoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPBG (NP_006661, 219 a.a. ~ 328 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7162

Enviar uma mensagem


TPBG polyclonal antibody (A01)

TPBG polyclonal antibody (A01)