TP53BP1 monoclonal antibody (M01), clone 1B9
  • TP53BP1 monoclonal antibody (M01), clone 1B9

TP53BP1 monoclonal antibody (M01), clone 1B9

Ref: AB-H00007158-M01
TP53BP1 monoclonal antibody (M01), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TP53BP1.
Información adicional
Size 100 ug
Gene Name TP53BP1
Gene Alias 53BP1|FLJ41424|MGC138366|p202
Gene Description tumor protein p53 binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53BP1 (NP_005648, 1766 a.a. ~ 1874 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7158
Clone Number 1B9
Iso type IgG1 Kappa

Enviar uma mensagem


TP53BP1 monoclonal antibody (M01), clone 1B9

TP53BP1 monoclonal antibody (M01), clone 1B9