TP53 purified MaxPab rabbit polyclonal antibody (D02P)
  • TP53 purified MaxPab rabbit polyclonal antibody (D02P)

TP53 purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00007157-D02P
TP53 purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TP53 protein.
Información adicional
Size 100 ug
Gene Name TP53
Gene Alias FLJ92943|LFS1|TRP53|p53
Gene Description tumor protein p53
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TP53 (NP_000537.2, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7157

Enviar uma mensagem


TP53 purified MaxPab rabbit polyclonal antibody (D02P)

TP53 purified MaxPab rabbit polyclonal antibody (D02P)