TOP1 monoclonal antibody (M01), clone 1A1
  • TOP1 monoclonal antibody (M01), clone 1A1

TOP1 monoclonal antibody (M01), clone 1A1

Ref: AB-H00007150-M01
TOP1 monoclonal antibody (M01), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TOP1.
Información adicional
Size 100 ug
Gene Name TOP1
Gene Alias TOPI
Gene Description topoisomerase (DNA) I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7150
Clone Number 1A1
Iso type IgG1 Kappa

Enviar uma mensagem


TOP1 monoclonal antibody (M01), clone 1A1

TOP1 monoclonal antibody (M01), clone 1A1