TOP1 polyclonal antibody (A01)
  • TOP1 polyclonal antibody (A01)

TOP1 polyclonal antibody (A01)

Ref: AB-H00007150-A01
TOP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOP1.
Información adicional
Size 50 uL
Gene Name TOP1
Gene Alias TOPI
Gene Description topoisomerase (DNA) I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7150

Enviar uma mensagem


TOP1 polyclonal antibody (A01)

TOP1 polyclonal antibody (A01)