TNR polyclonal antibody (A01)
  • TNR polyclonal antibody (A01)

TNR polyclonal antibody (A01)

Ref: AB-H00007143-A01
TNR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNR.
Información adicional
Size 50 uL
Gene Name TNR
Gene Alias MGC149328|TN-R
Gene Description tenascin R (restrictin, janusin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VATHLSTPQGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNR (NP_003276, 411 a.a. ~ 519 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7143

Enviar uma mensagem


TNR polyclonal antibody (A01)

TNR polyclonal antibody (A01)