TNP1 monoclonal antibody (M01), clone 1B5
  • TNP1 monoclonal antibody (M01), clone 1B5

TNP1 monoclonal antibody (M01), clone 1B5

Ref: AB-H00007141-M01
TNP1 monoclonal antibody (M01), clone 1B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TNP1.
Información adicional
Size 100 ug
Gene Name TNP1
Gene Alias TP1
Gene Description transition protein 1 (during histone to protamine replacement)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNP1 (AAH29516.1, 1 a.a. ~ 55 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7141
Clone Number 1B5
Iso type IgG2b kappa

Enviar uma mensagem


TNP1 monoclonal antibody (M01), clone 1B5

TNP1 monoclonal antibody (M01), clone 1B5