TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)
  • TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)

TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)

Ref: AB-H00007138-D02P
TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNNT1 protein.
Información adicional
Size 100 ug
Gene Name TNNT1
Gene Alias ANM|FLJ98147|MGC104241|STNT|TNT|TNTS
Gene Description troponin T type 1 (skeletal, slow)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNNT1 (AAH10963.1, 1 a.a. ~ 262 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7138

Enviar uma mensagem


TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)

TNNT1 purified MaxPab rabbit polyclonal antibody (D02P)