TNFAIP2 polyclonal antibody (A01)
  • TNFAIP2 polyclonal antibody (A01)

TNFAIP2 polyclonal antibody (A01)

Ref: AB-H00007127-A01
TNFAIP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFAIP2.
Información adicional
Size 50 uL
Gene Name TNFAIP2
Gene Alias B94
Gene Description tumor necrosis factor, alpha-induced protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFAIP2 (NP_006282, 552 a.a. ~ 650 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7127

Enviar uma mensagem


TNFAIP2 polyclonal antibody (A01)

TNFAIP2 polyclonal antibody (A01)