TNFAIP1 polyclonal antibody (A01)
  • TNFAIP1 polyclonal antibody (A01)

TNFAIP1 polyclonal antibody (A01)

Ref: AB-H00007126-A01
TNFAIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFAIP1.
Información adicional
Size 50 uL
Gene Name TNFAIP1
Gene Alias B12|B61|EDP1|MGC2317
Gene Description tumor necrosis factor, alpha-induced protein 1 (endothelial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFAIP1 (NP_066960, 258 a.a. ~ 316 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7126

Enviar uma mensagem


TNFAIP1 polyclonal antibody (A01)

TNFAIP1 polyclonal antibody (A01)