TSPAN6 monoclonal antibody (M06), clone 1H1
  • TSPAN6 monoclonal antibody (M06), clone 1H1

TSPAN6 monoclonal antibody (M06), clone 1H1

Ref: AB-H00007105-M06
TSPAN6 monoclonal antibody (M06), clone 1H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSPAN6.
Información adicional
Size 100 ug
Gene Name TSPAN6
Gene Alias T245|TM4SF6|TSPAN-6
Gene Description tetraspanin 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN6 (AAH12389, 115 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7105
Clone Number 1H1
Iso type IgG1 Kappa

Enviar uma mensagem


TSPAN6 monoclonal antibody (M06), clone 1H1

TSPAN6 monoclonal antibody (M06), clone 1H1