TSPAN8 monoclonal antibody (M02), clone 1E5
  • TSPAN8 monoclonal antibody (M02), clone 1E5

TSPAN8 monoclonal antibody (M02), clone 1E5

Ref: AB-H00007103-M02
TSPAN8 monoclonal antibody (M02), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
Información adicional
Size 100 ug
Gene Name TSPAN8
Gene Alias CO-029|TM4SF3
Gene Description tetraspanin 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7103
Clone Number 1E5
Iso type IgG3 Lambda

Enviar uma mensagem


TSPAN8 monoclonal antibody (M02), clone 1E5

TSPAN8 monoclonal antibody (M02), clone 1E5