TSPAN7 polyclonal antibody (A01)
  • TSPAN7 polyclonal antibody (A01)

TSPAN7 polyclonal antibody (A01)

Ref: AB-H00007102-A01
TSPAN7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSPAN7.
Información adicional
Size 50 uL
Gene Name TSPAN7
Gene Alias A15|CCG-B7|CD231|DXS1692E|MRX58|MXS1|TALLA-1|TM4SF2|TM4SF2b
Gene Description tetraspanin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPAN7 (NP_004606, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7102

Enviar uma mensagem


TSPAN7 polyclonal antibody (A01)

TSPAN7 polyclonal antibody (A01)