TLR5 monoclonal antibody (M13C), clone 2E1
  • TLR5 monoclonal antibody (M13C), clone 2E1

TLR5 monoclonal antibody (M13C), clone 2E1

Ref: AB-H00007100-M13C
TLR5 monoclonal antibody (M13C), clone 2E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR5.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name TLR5
Gene Alias FLJ10052|MGC126430|MGC126431|SLEB1|TIL3
Gene Description toll-like receptor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR5 (NP_003259.2, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 7100
Clone Number 20
Iso type IgG2b Kappa

Enviar uma mensagem


TLR5 monoclonal antibody (M13C), clone 2E1

TLR5 monoclonal antibody (M13C), clone 2E1