TLR4 monoclonal antibody (M03), clone 1H7
  • TLR4 monoclonal antibody (M03), clone 1H7

TLR4 monoclonal antibody (M03), clone 1H7

Ref: AB-H00007099-M03
TLR4 monoclonal antibody (M03), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR4.
Información adicional
Size 100 ug
Gene Name TLR4
Gene Alias ARMD10|CD284|TOLL|hToll
Gene Description toll-like receptor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7099
Clone Number 1H7
Iso type IgG2a Kappa

Enviar uma mensagem


TLR4 monoclonal antibody (M03), clone 1H7

TLR4 monoclonal antibody (M03), clone 1H7