TLR3 polyclonal antibody (A01)
  • TLR3 polyclonal antibody (A01)

TLR3 polyclonal antibody (A01)

Ref: AB-H00007098-A01
TLR3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TLR3.
Información adicional
Size 50 uL
Gene Name TLR3
Gene Alias CD283
Gene Description toll-like receptor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR3 (NP_003256, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7098

Enviar uma mensagem


TLR3 polyclonal antibody (A01)

TLR3 polyclonal antibody (A01)