TLR2 monoclonal antibody (M09), clone 1B10
  • TLR2 monoclonal antibody (M09), clone 1B10

TLR2 monoclonal antibody (M09), clone 1B10

Ref: AB-H00007097-M09
TLR2 monoclonal antibody (M09), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR2.
Información adicional
Size 100 ug
Gene Name TLR2
Gene Alias CD282|TIL4
Gene Description toll-like receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR2 (AAH33756.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7097
Clone Number 1B10
Iso type IgG2a Kappa

Enviar uma mensagem


TLR2 monoclonal antibody (M09), clone 1B10

TLR2 monoclonal antibody (M09), clone 1B10