TLR1 polyclonal antibody (A01)
  • TLR1 polyclonal antibody (A01)

TLR1 polyclonal antibody (A01)

Ref: AB-H00007096-A01
TLR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TLR1.
Información adicional
Size 50 uL
Gene Name TLR1
Gene Alias CD281|DKFZp547I0610|DKFZp564I0682|KIAA0012|MGC104956|MGC126311|MGC126312|TIL|rsc786
Gene Description toll-like receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR1 (NP_003254, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7096

Enviar uma mensagem


TLR1 polyclonal antibody (A01)

TLR1 polyclonal antibody (A01)