TLN1 monoclonal antibody (M13), clone 8B11
  • TLN1 monoclonal antibody (M13), clone 8B11

TLN1 monoclonal antibody (M13), clone 8B11

Ref: AB-H00007094-M13
TLN1 monoclonal antibody (M13), clone 8B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLN1.
Información adicional
Size 100 ug
Gene Name TLN1
Gene Alias ILWEQ|KIAA1027|TLN
Gene Description talin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLN1 (AAH42923, 1324 a.a. ~ 1424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7094
Clone Number 8B11
Iso type IgG1 Kappa

Enviar uma mensagem


TLN1 monoclonal antibody (M13), clone 8B11

TLN1 monoclonal antibody (M13), clone 8B11