TLL1 MaxPab mouse polyclonal antibody (B01)
  • TLL1 MaxPab mouse polyclonal antibody (B01)

TLL1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007092-B01
TLL1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TLL1 protein.
Información adicional
Size 50 uL
Gene Name TLL1
Gene Alias TLL
Gene Description tolloid-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TLL1 (AAH16922.1, 1 a.a. ~ 392 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7092

Enviar uma mensagem


TLL1 MaxPab mouse polyclonal antibody (B01)

TLL1 MaxPab mouse polyclonal antibody (B01)