TLE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TLE1 purified MaxPab rabbit polyclonal antibody (D01P)

TLE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007088-D01P
TLE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TLE1 protein.
Información adicional
Size 100 ug
Gene Name TLE1
Gene Alias ESG|ESG1|GRG1
Gene Description transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TLE1 (NP_005068.2, 1 a.a. ~ 770 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7088

Enviar uma mensagem


TLE1 purified MaxPab rabbit polyclonal antibody (D01P)

TLE1 purified MaxPab rabbit polyclonal antibody (D01P)