TKT purified MaxPab mouse polyclonal antibody (B01P)
  • TKT purified MaxPab mouse polyclonal antibody (B01P)

TKT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007086-B01P
TKT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TKT protein.
Información adicional
Size 50 ug
Gene Name TKT
Gene Alias FLJ34765|TKT1
Gene Description transketolase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TKT (NP_001055.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7086

Enviar uma mensagem


TKT purified MaxPab mouse polyclonal antibody (B01P)

TKT purified MaxPab mouse polyclonal antibody (B01P)