TK1 polyclonal antibody (A02)
  • TK1 polyclonal antibody (A02)

TK1 polyclonal antibody (A02)

Ref: AB-H00007083-A02
TK1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TK1.
Información adicional
Size 50 uL
Gene Name TK1
Gene Alias TK2
Gene Description thymidine kinase 1, soluble
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TK1 (NP_003249, 157 a.a. ~ 234 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7083

Enviar uma mensagem


TK1 polyclonal antibody (A02)

TK1 polyclonal antibody (A02)