TIMP2 monoclonal antibody (M01J), clone 5D7
  • TIMP2 monoclonal antibody (M01J), clone 5D7

TIMP2 monoclonal antibody (M01J), clone 5D7

Ref: AB-H00007077-M01J
TIMP2 monoclonal antibody (M01J), clone 5D7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TIMP2.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name TIMP2
Gene Alias CSC-21K
Gene Description TIMP metallopeptidase inhibitor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7077
Clone Number 5D7
Iso type IgG2a Kappa

Enviar uma mensagem


TIMP2 monoclonal antibody (M01J), clone 5D7

TIMP2 monoclonal antibody (M01J), clone 5D7