TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)

TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007077-D01P
TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TIMP2 protein.
Información adicional
Size 100 ug
Gene Name TIMP2
Gene Alias CSC-21K
Gene Description TIMP metallopeptidase inhibitor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TIMP2 (NP_003246.1, 1 a.a. ~ 220 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7077

Enviar uma mensagem


TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)

TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)