TIE1 monoclonal antibody (M19), clone 2C7
  • TIE1 monoclonal antibody (M19), clone 2C7

TIE1 monoclonal antibody (M19), clone 2C7

Ref: AB-H00007075-M19
TIE1 monoclonal antibody (M19), clone 2C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TIE1.
Información adicional
Size 100 ug
Gene Name TIE1
Gene Alias JTK14|TIE
Gene Description tyrosine kinase with immunoglobulin-like and EGF-like domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7075
Clone Number 2C7
Iso type IgG2a Kappa

Enviar uma mensagem


TIE1 monoclonal antibody (M19), clone 2C7

TIE1 monoclonal antibody (M19), clone 2C7