TIA1 MaxPab rabbit polyclonal antibody (D01)
  • TIA1 MaxPab rabbit polyclonal antibody (D01)

TIA1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007072-D01
TIA1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TIA1 protein.
Información adicional
Size 100 uL
Gene Name TIA1
Gene Alias -
Gene Description TIA1 cytotoxic granule-associated RNA binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TIA1 (AAH15944.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7072

Enviar uma mensagem


TIA1 MaxPab rabbit polyclonal antibody (D01)

TIA1 MaxPab rabbit polyclonal antibody (D01)