KLF10 monoclonal antibody (M61), clone 2D2 View larger

Mouse monoclonal antibody raised against a partial recombinant KLF10.

AB-H00007071-M61

New product

KLF10 monoclonal antibody (M61), clone 2D2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name KLF10
Gene Alias EGRA|TIEG|TIEG1
Gene Description Kruppel-like factor 10
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7071
Clone Number 2D2
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Mouse monoclonal antibody raised against a partial recombinant KLF10.