THY1 polyclonal antibody (A01)
  • THY1 polyclonal antibody (A01)

THY1 polyclonal antibody (A01)

Ref: AB-H00007070-A01
THY1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant THY1.
Información adicional
Size 50 uL
Gene Name THY1
Gene Alias CD90|FLJ33325
Gene Description Thy-1 cell surface antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THY1 (NP_006279, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7070

Enviar uma mensagem


THY1 polyclonal antibody (A01)

THY1 polyclonal antibody (A01)