THRA purified MaxPab rabbit polyclonal antibody (D01P)
  • THRA purified MaxPab rabbit polyclonal antibody (D01P)

THRA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007067-D01P
THRA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human THRA protein.
Información adicional
Size 100 ug
Gene Name THRA
Gene Alias AR7|EAR7|ERB-T-1|ERBA|ERBA1|MGC000261|MGC43240|NR1A1|THRA1|THRA2|c-ERBA-1
Gene Description thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THRA (NP_955366.1, 1 a.a. ~ 410 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7067

Enviar uma mensagem


THRA purified MaxPab rabbit polyclonal antibody (D01P)

THRA purified MaxPab rabbit polyclonal antibody (D01P)