THRA polyclonal antibody (A01)
  • THRA polyclonal antibody (A01)

THRA polyclonal antibody (A01)

Ref: AB-H00007067-A01
THRA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant THRA.
Información adicional
Size 50 uL
Gene Name THRA
Gene Alias AR7|EAR7|ERB-T-1|ERBA|ERBA1|MGC000261|MGC43240|NR1A1|THRA1|THRA2|c-ERBA-1
Gene Description thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THRA (AAH02728, 87 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7067

Enviar uma mensagem


THRA polyclonal antibody (A01)

THRA polyclonal antibody (A01)