TGM4 purified MaxPab mouse polyclonal antibody (B01P)
  • TGM4 purified MaxPab mouse polyclonal antibody (B01P)

TGM4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007047-B01P
TGM4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TGM4 protein.
Información adicional
Size 50 ug
Gene Name TGM4
Gene Alias FLJ26776|TGP|hTGP
Gene Description transglutaminase 4 (prostate)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MMDASKELQVLHIDFLNQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKLEFSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNVKTGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGVLIGNWTGDYEGGTAPYKWTGSAPILQQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TGM4 (AAH07003.1, 1 a.a. ~ 684 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7047

Enviar uma mensagem


TGM4 purified MaxPab mouse polyclonal antibody (B01P)

TGM4 purified MaxPab mouse polyclonal antibody (B01P)