TGFB1I1 MaxPab mouse polyclonal antibody (B01P)
  • TGFB1I1 MaxPab mouse polyclonal antibody (B01P)

TGFB1I1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007041-B01P
TGFB1I1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TGFB1I1 protein.
Información adicional
Size 50 ug
Gene Name TGFB1I1
Gene Alias ARA55|HIC-5|HIC5|TSC-5
Gene Description transforming growth factor beta 1 induced transcript 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TGFB1I1 (NP_057011.2, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7041

Enviar uma mensagem


TGFB1I1 MaxPab mouse polyclonal antibody (B01P)

TGFB1I1 MaxPab mouse polyclonal antibody (B01P)