TGFB1 monoclonal antibody (M04), clone X1
  • TGFB1 monoclonal antibody (M04), clone X1

TGFB1 monoclonal antibody (M04), clone X1

Ref: AB-H00007040-M04
TGFB1 monoclonal antibody (M04), clone X1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TGFB1.
Información adicional
Size 100 ug
Gene Name TGFB1
Gene Alias CED|DPD1|TGFB|TGFbeta
Gene Description transforming growth factor, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,PLA-Ce
Immunogen Prot. Seq ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGFB1 (NP_000651, 279 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7040
Clone Number X1
Iso type IgG2b Kappa

Enviar uma mensagem


TGFB1 monoclonal antibody (M04), clone X1

TGFB1 monoclonal antibody (M04), clone X1