TGFA purified MaxPab rabbit polyclonal antibody (D01P)
  • TGFA purified MaxPab rabbit polyclonal antibody (D01P)

TGFA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007039-D01P
TGFA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TGFA protein.
Información adicional
Size 100 ug
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TGFA (NP_003227.1, 1 a.a. ~ 160 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7039

Enviar uma mensagem


TGFA purified MaxPab rabbit polyclonal antibody (D01P)

TGFA purified MaxPab rabbit polyclonal antibody (D01P)