TGFA polyclonal antibody (A01)
  • TGFA polyclonal antibody (A01)

TGFA polyclonal antibody (A01)

Ref: AB-H00007039-A01
TGFA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TGFA.
Información adicional
Size 50 uL
Gene Name TGFA
Gene Alias TFGA
Gene Description transforming growth factor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGFA (NP_003227, 42 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7039

Enviar uma mensagem


TGFA polyclonal antibody (A01)

TGFA polyclonal antibody (A01)