TFRC monoclonal antibody (M02), clone 1H5
  • TFRC monoclonal antibody (M02), clone 1H5

TFRC monoclonal antibody (M02), clone 1H5

Ref: AB-H00007037-M02
TFRC monoclonal antibody (M02), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFRC.
Información adicional
Size 100 ug
Gene Name TFRC
Gene Alias CD71|TFR|TFR1|TRFR
Gene Description transferrin receptor (p90, CD71)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFRC (AAH01188, 68 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7037
Clone Number 1H5
Iso type IgG2b Kappa

Enviar uma mensagem


TFRC monoclonal antibody (M02), clone 1H5

TFRC monoclonal antibody (M02), clone 1H5