TFF3 monoclonal antibody (M01), clone 3D9
  • TFF3 monoclonal antibody (M01), clone 3D9

TFF3 monoclonal antibody (M01), clone 3D9

Ref: AB-H00007033-M01
TFF3 monoclonal antibody (M01), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TFF3.
Información adicional
Size 100 ug
Gene Name TFF3
Gene Alias HITF|ITF|TFI|hP1.B
Gene Description trefoil factor 3 (intestinal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7033
Clone Number 3D9
Iso type IgG1 Kappa

Enviar uma mensagem


TFF3 monoclonal antibody (M01), clone 3D9

TFF3 monoclonal antibody (M01), clone 3D9