TFF2 monoclonal antibody (M01), clone 2A10
  • TFF2 monoclonal antibody (M01), clone 2A10

TFF2 monoclonal antibody (M01), clone 2A10

Ref: AB-H00007032-M01
TFF2 monoclonal antibody (M01), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TFF2.
Información adicional
Size 100 ug
Gene Name TFF2
Gene Alias SML1|SP
Gene Description trefoil factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFF2 (AAH32820, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7032
Clone Number 2A10
Iso type IgG2a Kappa

Enviar uma mensagem


TFF2 monoclonal antibody (M01), clone 2A10

TFF2 monoclonal antibody (M01), clone 2A10