TFE3 polyclonal antibody (A01)
  • TFE3 polyclonal antibody (A01)

TFE3 polyclonal antibody (A01)

Ref: AB-H00007030-A01
TFE3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFE3.
Información adicional
Size 50 uL
Gene Name TFE3
Gene Alias RCCP2|TFEA|bHLHe33
Gene Description transcription factor binding to IGHM enhancer 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFE3 (NP_006512, 166 a.a. ~ 254 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7030

Enviar uma mensagem


TFE3 polyclonal antibody (A01)

TFE3 polyclonal antibody (A01)