View larger
Mouse polyclonal antibody raised against a partial recombinant TFCP2.
AB-H00007024-A01
New product
TFCP2 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | TFCP2 |
| Gene Alias | CP2|LBP-1C|LSF|SEF|TFCP2C |
| Gene Description | transcription factor CP2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,ELISA |
| Immunogen Prot. Seq | KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TFCP2 (AAH03634, 414 a.a. ~ 502 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 7024 |
More info
Mouse polyclonal antibody raised against a partial recombinant TFCP2.