TFAP4 monoclonal antibody (M02), clone 7C5
  • TFAP4 monoclonal antibody (M02), clone 7C5

TFAP4 monoclonal antibody (M02), clone 7C5

Ref: AB-H00007023-M02
TFAP4 monoclonal antibody (M02), clone 7C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFAP4.
Información adicional
Size 50 ug
Gene Name TFAP4
Gene Alias AP-4|bHLHc41
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7023
Clone Number 7C5
Iso type IgG2a Kappa

Enviar uma mensagem


TFAP4 monoclonal antibody (M02), clone 7C5

TFAP4 monoclonal antibody (M02), clone 7C5