TFAP4 polyclonal antibody (A01)
  • TFAP4 polyclonal antibody (A01)

TFAP4 polyclonal antibody (A01)

Ref: AB-H00007023-A01
TFAP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFAP4.
Información adicional
Size 50 uL
Gene Name TFAP4
Gene Alias AP-4|bHLHc41
Gene Description transcription factor AP-4 (activating enhancer binding protein 4)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP4 (NP_003214, 93 a.a. ~ 192 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7023

Enviar uma mensagem


TFAP4 polyclonal antibody (A01)

TFAP4 polyclonal antibody (A01)