TFAP2C monoclonal antibody (M01), clone 3C8
  • TFAP2C monoclonal antibody (M01), clone 3C8

TFAP2C monoclonal antibody (M01), clone 3C8

Ref: AB-H00007022-M01
TFAP2C monoclonal antibody (M01), clone 3C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFAP2C.
Información adicional
Size 100 ug
Gene Name TFAP2C
Gene Alias AP2-GAMMA|ERF1|TFAP2G|hAP-2g
Gene Description transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFAP2C (NP_003213, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7022
Clone Number 3C8
Iso type IgG1 Kappa

Enviar uma mensagem


TFAP2C monoclonal antibody (M01), clone 3C8

TFAP2C monoclonal antibody (M01), clone 3C8